General Information

  • ID:  hor006624
  • Uniprot ID:  P25687(1-81)
  • Protein name:  Toxin MIT1
  • Gene name:  NA
  • Organism:  Dendroaspis polylepis polylepis (Black mamba)
  • Family:  AVIT (prokineticin) family
  • Source:  animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Dendroaspis polylepis (species), Dendroaspis (genus), Elapinae (subfamily), Elapidae (family), Colubroidea (superfamily), Serpentes (infraorder), Toxicofera , Episquamata , Unidentata , Bifurcata , Squamata (order), Lepidosauria (class), Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0090729 toxin activity
  • GO BP:  GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSKS
  • Length:  81(1-81)
  • Propeptide:  AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSKS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potent agonist for both PKR1/PROKR1 and PKR2/PROKR2 (PubMed:12054613). Potently contracts gastrointestinal (GI) smooth muscle (PubMed:10567694).
  • Mechanism:  Negative results: does not inhibit Kv1.1/KCNA1, Kv1.2/KCNA2, Kv1.3/KCNA3, Kv1.4/KCNA4, Kv1.5/KCNA5, Kv2.1/KCNB1, Kv3.4/KCNC4, Kv4.2/KCND2, K2P2.1/KCNK2, Kv11/KCNH, Kv7.1/KCNQ1, Kv7.2/KCNQ2, Kv7.3/KCNQ3, Kir1.1/KCNJ1, Kir2.1/KCNJ2, Kir2.2/KCNJ12, Kir3.1/KCNJ3-Kir3.2/KCNJ6 (GIRK1,2) and Kir3.1/KCNJ3-Kir3.4/KCNJ5 (GIRK1,4).
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-19; 13-31; 18-59; 41-67; 61-77
  • Structure ID:  AF-P25687-F1(AlphaFold_DB_ID)/1IMT(PDB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P25687-F1.pdb1imt.pdbhor006624_AF2.pdbhor006624_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 1003122 Formula: C365H594N110O108S11
Absent amino acids: Y Common amino acids: C
pI: 8.59 Basic residues: 14
Polar residues: 31 Hydrophobic residues: 22
Hydrophobicity: -9.75 Boman Index: -10057
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 62.59
Instability Index: 5113.33 Extinction Coefficient cystines: 6125
Absorbance 280nm: 76.56

Literature

  • PubMed ID:  10567694
  • Title:  MIT(1), a black mamba toxin with a new and highly potent activity on intestinal contraction.
  • PubMed ID:  7461607
  • Title:  Snake venom. The amino acid sequence of protein A from Dendroaspis polylepis polylepis (black mamba) venom.
  • PubMed ID:  12054613
  • Title:  Isolation and identification of EG-VEGF/prokineticin
  • PubMed ID:  9761684
  • Title: